Recombinant Human FXYD2 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant b (NM_021603).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID P54710
Entry Name ATNG_HUMAN
Gene Names FXYD2 ATP1C ATP1G1
Alternative Gene Names ATP1C ATP1G1
Alternative Protein Names Sodium/potassium-transporting ATPase subunit gamma (Na(+)/K(+) ATPase subunit gamma) (FXYD domain-containing ion transport regulator 2) (Sodium pump gamma chain)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 66
Molecular Weight(Da) 7283
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP
Background
Function FUNCTION: May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase.
Pathway
Protein Families FXYD family
Tissue Specificity Expressed in the distal convoluted tubule in the kidney. Found on basolateral membranes of nephron epithelial cells.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8998625

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human FXYD2 protein
Copyright © 2026-present Echo Bio. All rights reserved.